PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S05011.40
Common NameJCGZ_04882, LOC105634233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 409aa    MW: 45828.2 Da    PI: 6.8786
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S05011.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.99.4e-33265320156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Jcr4S05011.40 265 KQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 320
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.115262322IPR017930Myb domain
SuperFamilySSF466892.84E-18262323IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-30263324IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-27265320IPR006447Myb domain, plants
PfamPF002496.4E-8267318IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MGSIPPELSL DFRPTYVPKT ISDFLKEVSM IGDVSEKVSK LDGFVKGLEE EMRKIDAFKR  60
ELPLCMLLLN DAILFLKTES MQCTPSNNRP VLEEFIPLKK SDEEEEEEEE ESPIKKEKDY  120
KDKKNWMSSV QLWNSNEHSS TDYIFDPKQN LKLEYKSTKK GNQYANEDTF QACKSRNAAR  180
AFMPFKTYTG LSRKEDSNKN HNQNSEELPI PGLSLLTPGI KNLREESVST GSRTSCSRAV  240
SSSAPNPQLN LRNGLQPSQQ QTARKQRRCW SPELHRRFVN ALQQLGGSQA ATPKQIRELM  300
QVDGLTNDEV KSHLQKYRLH TRRMPTATAA PANQSLVVLG GLWVSQDQYG DSSKATSSQS  360
GSPQGPLQLA GNTGGTSTTG GDSMEDDEDA KSEGYSWKSH IHRSGKDDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072452.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA0A067L2E90.0A0A067L2E9_JATCU; Uncharacterized protein
STRINGPOPTR_0004s15220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-57G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]